| Brand:  | Abnova | 
| Reference:  | H00006198-M01 | 
| Product name:  | RPS6KB1 monoclonal antibody (M01), clone 1E12 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant RPS6KB1. | 
| Clone:  | 1E12 | 
| Isotype:  | IgG2b Kappa | 
| Gene id:  | 6198 | 
| Gene name:  | RPS6KB1 | 
| Gene alias:  | PS6K|S6K|S6K1|STK14A|p70(S6K)-alpha|p70-S6K|p70-alpha | 
| Gene description:  | ribosomal protein S6 kinase, 70kDa, polypeptide 1 | 
| Genbank accession:  | NM_003161 | 
| Immunogen:  | RPS6KB1 (NP_003152, 416 a.a. ~ 525 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | PSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL | 
| Protein accession:  | NP_003152 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (37.84 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Immunoperoxidase of monoclonal antibody to RPS6KB1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 0.5 ug/ml] | 
| Applications:  | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |