| Brand: | Abnova |
| Reference: | H00006197-M01 |
| Product name: | RPS6KA3 monoclonal antibody (M01), clone 2G10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RPS6KA3. |
| Clone: | 2G10 |
| Isotype: | IgG2b Kappa |
| Gene id: | 6197 |
| Gene name: | RPS6KA3 |
| Gene alias: | CLS|HU-3|ISPK-1|MAPKAPK1B|MRX19|RSK|RSK2|S6K-alpha3|p90-RSK2|pp90RSK2 |
| Gene description: | ribosomal protein S6 kinase, 90kDa, polypeptide 3 |
| Genbank accession: | NM_004586 |
| Immunogen: | RPS6KA3 (NP_004577, 2 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQ |
| Protein accession: | NP_004577 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.08 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | RPS6KA3 monoclonal antibody (M01), clone 2G10. Western Blot analysis of RPS6KA3 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,IF,ELISA,WB-Re,PLA-Ce |
| Shipping condition: | Dry Ice |