| Brand:  | Abnova | 
| Reference:  | H00006191-M01A | 
| Product name:  | RPS4X monoclonal antibody (M01A), clone 3E10 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant RPS4X. | 
| Clone:  | 3E10 | 
| Isotype:  | IgM Kappa | 
| Gene id:  | 6191 | 
| Gene name:  | RPS4X | 
| Gene alias:  | CCG2|DXS306|FLJ40595|SCAR|SCR10 | 
| Gene description:  | ribosomal protein S4, X-linked | 
| Genbank accession:  | NM_001007 | 
| Immunogen:  | RPS4X (NP_000998, 74 a.a. ~ 177 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | GKVRTDITYPAGFMDVISIDKTGENFRLIYDTKGRFAVHRITPEEAKYKLCKVRKIFVGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDT | 
| Protein accession:  | NP_000998 | 
| Storage buffer:  | In ascites fluid | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Applications:  | ELISA | 
| Shipping condition:  | Dry Ice |