| Brand: | Abnova |
| Reference: | H00006189-A01 |
| Product name: | RPS3A polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant RPS3A. |
| Gene id: | 6189 |
| Gene name: | RPS3A |
| Gene alias: | FTE1|MFTL|MGC23240 |
| Gene description: | ribosomal protein S3A |
| Genbank accession: | NM_001006 |
| Immunogen: | RPS3A (NP_000997, 164 a.a. ~ 263 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | IRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEKACQSIYPLHDVFVRKVKMLKKPKFELGKLMELHGEGSSSGKATGDETGAKVERADGYEPPVQES |
| Protein accession: | NP_000997 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | RPS3A polyclonal antibody (A01), Lot # ONW0060316QCS1 Western Blot analysis of RPS3A expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Monoclonal antibodies against human translation termination factor eRF3 and their utilisation for subcellular localisation of eRF3.Delage M, Dutertre S, Le Guevel R, Frolova L, Berkova N. J Biochem. 2011 Mar 18. [Epub ahead of print] |