| Brand:  | Abnova | 
| Reference:  | H00006187-M01 | 
| Product name:  | RPS2 monoclonal antibody (M01), clone 3G6 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant RPS2. | 
| Clone:  | 3G6 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 6187 | 
| Gene name:  | RPS2 | 
| Gene alias:  | LLREP3|MGC102851|MGC117344|MGC117345 | 
| Gene description:  | ribosomal protein S2 | 
| Genbank accession:  | NM_002952 | 
| Immunogen:  | RPS2 (NP_002943, 198 a.a. ~ 293 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | APRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRVSVQRTQAPAVATT | 
| Protein accession:  | NP_002943 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (36.3 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Immunoperoxidase of monoclonal antibody to RPS2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1.2 ug/ml] | 
| Applications:  | WB-Ti,IHC-P,IF,S-ELISA,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice | 
| Publications:  | PRMT3 is essential for dendritic spine maturation in rat hippocampal neurons.Miyata S, Mori Y, Tohyama M. Brain Res. 2010 Sep 17;1352C:11-20. Epub 2010 Jul 18. |