RPL32 monoclonal antibody (M01), clone 1C3 View larger

RPL32 monoclonal antibody (M01), clone 1C3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RPL32 monoclonal antibody (M01), clone 1C3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about RPL32 monoclonal antibody (M01), clone 1C3

Brand: Abnova
Reference: H00006161-M01
Product name: RPL32 monoclonal antibody (M01), clone 1C3
Product description: Mouse monoclonal antibody raised against a partial recombinant RPL32.
Clone: 1C3
Isotype: IgG2a Kappa
Gene id: 6161
Gene name: RPL32
Gene alias: PP9932
Gene description: ribosomal protein L32
Genbank accession: NM_000994
Immunogen: RPL32 (NP_000985, 33 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLLMCNKSYCAEIAHNVSSKNRKAIVERAAQLAIRVTNPNARLRSE
Protein accession: NP_000985
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006161-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged RPL32 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy RPL32 monoclonal antibody (M01), clone 1C3 now

Add to cart