View larger

RPL27A polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of RPL27A polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00006157-A01
Product name:	RPL27A polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant RPL27A.
Gene id:	6157
Gene name:	RPL27A
Gene alias:	FLJ43464\|MGC10850\|MGC17878\|MGC87238
Gene description:	ribosomal protein L27a
Genbank accession:	NM_000990
Immunogen:	RPL27A (NP_000981, 49 a.a. ~ 148 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	HPGYFGKVGMKHYHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEKIKSVGGACVLVA
Protein accession:	NP_000981
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (37.11 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice