Brand: | Abnova |
Reference: | H00006137-M01 |
Product name: | RPL13 monoclonal antibody (M01), clone 3F6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RPL13. |
Clone: | 3F6 |
Isotype: | IgG2a Kappa |
Gene id: | 6137 |
Gene name: | RPL13 |
Gene alias: | BBC1|D16S444E|FLJ27453|FLJ27454|MGC117342|MGC71373 |
Gene description: | ribosomal protein L13 |
Genbank accession: | NM_000977 |
Immunogen: | RPL13 (NP_000968, 112 a.a. ~ 211 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ANVQRLKEYRSKLILFPRKPSAPKKGDSSAEELKLATQLTGPVMPVRNVYKKEKARVITEEEKNFKAFASLRMARANARLFGIRAKRAKEAAEQDVEKKK |
Protein accession: | NP_000968 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to RPL13 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |