| Brand: | Abnova |
| Reference: | H00006137-M01 |
| Product name: | RPL13 monoclonal antibody (M01), clone 3F6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RPL13. |
| Clone: | 3F6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6137 |
| Gene name: | RPL13 |
| Gene alias: | BBC1|D16S444E|FLJ27453|FLJ27454|MGC117342|MGC71373 |
| Gene description: | ribosomal protein L13 |
| Genbank accession: | NM_000977 |
| Immunogen: | RPL13 (NP_000968, 112 a.a. ~ 211 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ANVQRLKEYRSKLILFPRKPSAPKKGDSSAEELKLATQLTGPVMPVRNVYKKEKARVITEEEKNFKAFASLRMARANARLFGIRAKRAKEAAEQDVEKKK |
| Protein accession: | NP_000968 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to RPL13 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |