| Brand: | Abnova |
| Reference: | H00006133-M01 |
| Product name: | RPL9 monoclonal antibody (M01), clone 2F11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RPL9. |
| Clone: | 2F11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6133 |
| Gene name: | RPL9 |
| Gene alias: | DKFZp313J1510|FLJ27456|MGC15545|NPC-A-16 |
| Gene description: | ribosomal protein L9 |
| Genbank accession: | NM_000661 |
| Immunogen: | RPL9 (NP_000652, 93 a.a. ~ 191 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQAD |
| Protein accession: | NP_000652 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to RPL9 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Proteomic characterization of the human sperm nucleus.de Mateo S, Castillo J, Estanyol JM, Ballesca JL, Oliva R. PROTEOMICS DOI: 10.1002/ pmic.201000799 |