View larger

RPL3L polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of RPL3L polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00006123-A01
Product name:	RPL3L polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant RPL3L.
Gene id:	6123
Gene name:	RPL3L
Gene alias:	-
Gene description:	ribosomal protein L3-like
Genbank accession:	NM_005061
Immunogen:	RPL3L (NP_005052, 280 a.a. ~ 360 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	LNKKIFRIGRGPHMEDGKLVKNNASTSYDVTAKSITPLGGFPHYGEVNNDFVMLKGCIAGTKKRVITLRKSLLVHHSRQAV
Protein accession:	NP_005052
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (35.02 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice