RPA3 monoclonal antibody (M01), clone 1F4 View larger

RPA3 monoclonal antibody (M01), clone 1F4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RPA3 monoclonal antibody (M01), clone 1F4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about RPA3 monoclonal antibody (M01), clone 1F4

Brand: Abnova
Reference: H00006119-M01
Product name: RPA3 monoclonal antibody (M01), clone 1F4
Product description: Mouse monoclonal antibody raised against a partial recombinant RPA3.
Clone: 1F4
Isotype: IgG1 lambda
Gene id: 6119
Gene name: RPA3
Gene alias: REPA3
Gene description: replication protein A3, 14kDa
Genbank accession: BC005264
Immunogen: RPA3 (AAH05264, 12 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: INAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD
Protein accession: AAH05264
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006119-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006119-M01-3-33-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to RPA3 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy RPA3 monoclonal antibody (M01), clone 1F4 now

Add to cart