View larger

RORA polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of RORA polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00006095-A01
Product name:	RORA polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant RORA.
Gene id:	6095
Gene name:	RORA
Gene alias:	DKFZp686M2414\|MGC119326\|MGC119329\|NR1F1\|ROR1\|ROR2\|ROR3\|RZR-ALPHA\|RZRA
Gene description:	RAR-related orphan receptor A
Genbank accession:	NM_134261
Immunogen:	RORA (NP_599023, 424 a.a. ~ 523 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	SAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG
Protein accession:	NP_599023
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA
Shipping condition:	Dry Ice