No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,WB-Tr,Flow Cyt |
Brand: | Abnova |
Reference: | H00006094-B01P |
Product name: | ROM1 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human ROM1 protein. |
Gene id: | 6094 |
Gene name: | ROM1 |
Gene alias: | ROM|ROSP1|TSPAN23 |
Gene description: | retinal outer segment membrane protein 1 |
Genbank accession: | NM_000327.2 |
Immunogen: | ROM1 (NP_000318.1, 1 a.a. ~ 351 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MAPVLPLVLPLQPRIRLAQGLWLLSWLLALAGGVILLCSGHLLVQLRHLGTFLAPSCQFPVLPQAALAAGAVALGTGLVGVGASRASLNAALYPPWRGVLGPLLVAGTAGGGGLLVVALGLALALPGSLDEALEEGLVTALAHYKDTEVPGHCQAKRLVDELQLRYHCCGRHGYKDWFGVQWVSSRYLDPGDRDVADRIQSNVEGLYLTDGVPFSCCNPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGTLGSMLAVTFLLQALVLLGLRYLQTALEGLGGVIDAGGETQGYLFPSGLKDMLKTAWLQGGVACRPAPEEAPPGEAPPKEDLSEA |
Protein accession: | NP_000318.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | ROM1 MaxPab polyclonal antibody. Western Blot analysis of ROM1 expression in human kidney. |
Applications: | WB-Ti,WB-Tr,Flow Cyt |
Shipping condition: | Dry Ice |