| Brand: | Abnova |
| Reference: | H00006093-M01 |
| Product name: | ROCK1 monoclonal antibody (M01), clone 2E2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ROCK1. |
| Clone: | 2E2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6093 |
| Gene name: | ROCK1 |
| Gene alias: | MGC131603|MGC43611|P160ROCK|PRO0435 |
| Gene description: | Rho-associated, coiled-coil containing protein kinase 1 |
| Genbank accession: | NM_005406 |
| Immunogen: | ROCK1 (NP_005397, 401 a.a. ~ 510 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SNRRYLSSANPNDNRTSSNADKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLESTVSQIEKEKMLLQHRINEYQRKAEQENEKRR |
| Protein accession: | NP_005397 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to ROCK1 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Integration of virtual screening with high-throughput screening for the identification of novel Rho-kinase I inhibitors.Gong LL, Fang LH, Peng JH, Liu AL, Du GH. J Biotechnol. 2009 Dec 4. [Epub ahead of print] |