RNH1 polyclonal antibody (A01) View larger

RNH1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RNH1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,ELISA,WB-Re

More info about RNH1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00006050-A01
Product name: RNH1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant RNH1.
Gene id: 6050
Gene name: RNH1
Gene alias: MGC18200|MGC4569|MGC54054|RAI|RNH
Gene description: ribonuclease/angiogenin inhibitor 1
Genbank accession: NM_203389
Immunogen: RNH1 (NP_976323, 2 a.a. ~ 93 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: SLDIQSLDIQCEELSDARWAELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQ
Protein accession: NP_976323
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006050-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.23 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006050-A01-2-A5-1.jpg
Application image note: RNH1 polyclonal antibody (A01), Lot # 061025JCS1. Western Blot analysis of RNH1 expression in human ovarian cancer.
Applications: WB-Ti,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RNH1 polyclonal antibody (A01) now

Add to cart