View larger

RNF4 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of RNF4 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00006047-A01
Product name:	RNF4 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant RNF4.
Gene id:	6047
Gene name:	RNF4
Gene alias:	RES4-26\|SNURF
Gene description:	ring finger protein 4
Genbank accession:	NM_002938
Immunogen:	RNF4 (NP_002929, 107 a.a. ~ 190 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	YVTTHTPRNARDEGATGLRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI
Protein accession:	NP_002929
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (35.35 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	E1B-55K mediated regulation of RNF4 STUbL promotes HAdV gene expression.Muncheberg S, Hay RT, Ip WH, Meyer T, Weis C, Brenke J, Masser S, Hadian K, Dobner T, Schreiner S. J Virol. 2018 Jun 13;92(13). pii: e00164-18. doi: 10.1128/JVI.00164-18. Print 2018 Jul 1.