| Brand: | Abnova |
| Reference: | H00006046-M01 |
| Product name: | BRD2 monoclonal antibody (M01), clone 3D10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant BRD2. |
| Clone: | 3D10 |
| Isotype: | IgG2b Kappa |
| Gene id: | 6046 |
| Gene name: | BRD2 |
| Gene alias: | D6S113E|DKFZp686N0336|FLJ31942|FSH|FSRG1|KIAA9001|NAT|RING3|RNF3 |
| Gene description: | bromodomain containing 2 |
| Genbank accession: | NM_005104 |
| Immunogen: | BRD2 (NP_005095, 167 a.a. ~ 256 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHS |
| Protein accession: | NP_005095 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged BRD2 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma.Lee YS, Lee JW, Jang JW, Chi XZ, Kim JH, Li YH, Kim MK, Kim DM, Choi BS, Kim EG, Chung JH, Lee OJ, Lee YM, Suh JW, Chuang LS, Ito Y, Bae SC Cancer Cell. 2013 Nov 11;24(5):603-16. doi: 10.1016/j.ccr.2013.10.003. |