| Brand: | Abnova |
| Reference: | H00006045-M13 |
| Product name: | RNF2 monoclonal antibody (M13), clone 2F7 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant RNF2. |
| Clone: | 2F7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6045 |
| Gene name: | RNF2 |
| Gene alias: | BAP-1|BAP1|DING|HIPI3|RING1B|RING2 |
| Gene description: | ring finger protein 2 |
| Genbank accession: | NM_007212 |
| Immunogen: | RNF2 (NP_009143, 164 a.a. ~ 223 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDG |
| Protein accession: | NP_009143 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.34 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged RNF2 is approximately 30ng/ml as a capture antibody. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |