No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Mouse |
Applications | WB-Ce,WB-Ti,IF,S-ELISA,ELISA,WB-Tr |
Brand: | Abnova |
Reference: | H00006045-M03 |
Product name: | RNF2 monoclonal antibody (M03), clone 3G6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RNF2. |
Clone: | 3G6 |
Isotype: | IgG2a Kappa |
Gene id: | 6045 |
Gene name: | RNF2 |
Gene alias: | BAP-1|BAP1|DING|HIPI3|RING1B|RING2 |
Gene description: | ring finger protein 2 |
Genbank accession: | NM_007212 |
Immunogen: | RNF2 (NP_009143, 192 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQ |
Protein accession: | NP_009143 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | RNF2 monoclonal antibody (M03), clone 3G6. Western Blot analysis of RNF2 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,WB-Ti,IF,S-ELISA,ELISA,WB-Tr |
Shipping condition: | Dry Ice |