View larger

RNASE2 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of RNASE2 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00006036-A01
Product name:	RNASE2 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant RNASE2.
Gene id:	6036
Gene name:	RNASE2
Gene alias:	EDN\|RNS2
Gene description:	ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin)
Genbank accession:	NM_002934
Immunogen:	RNASE2 (NP_002925, 86 a.a. ~ 161 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	NMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII
Protein accession:	NP_002925
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (34.47 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	Enrichment of the Basic/Cationic Urinary Proteome Using Ion Exchange Chromatography and Batch Adsorption.Thongboonkerd V, Chutipongtanate S J Proteome Res. 2007 Mar;6(3):1209-14. Epub 2007 Jan 24.