| Brand: | Abnova |
| Reference: | H00006036-A01 |
| Product name: | RNASE2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant RNASE2. |
| Gene id: | 6036 |
| Gene name: | RNASE2 |
| Gene alias: | EDN|RNS2 |
| Gene description: | ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin) |
| Genbank accession: | NM_002934 |
| Immunogen: | RNASE2 (NP_002925, 86 a.a. ~ 161 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | NMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII |
| Protein accession: | NP_002925 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.47 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Enrichment of the Basic/Cationic Urinary Proteome Using Ion Exchange Chromatography and Batch Adsorption.Thongboonkerd V, Chutipongtanate S J Proteome Res. 2007 Mar;6(3):1209-14. Epub 2007 Jan 24. |