Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RLF monoclonal antibody (M05), clone 2G2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about RLF monoclonal antibody (M05), clone 2G2
| Brand: | Abnova |
| Reference: | H00006018-M05 |
| Product name: | RLF monoclonal antibody (M05), clone 2G2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RLF. |
| Clone: | 2G2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6018 |
| Gene name: | RLF |
| Gene alias: | MGC142226|ZN-15L|ZNF292L |
| Gene description: | rearranged L-myc fusion |
| Genbank accession: | NM_012421 |
| Immunogen: | RLF (NP_036553.1, 1805 a.a. ~ 1913 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SNDLTGNVVANNMVNDSEPEVDIPHSSSDSTIHENLTAIPPLIVAETTTVPSLENLRVVLDKALTDCGELALKQLHYLRPVVVLERSKFSTPILDLFPTKKTDELCVGS |
| Protein accession: | NP_036553.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged RLF is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Loss of Rearranged L-Myc Fusion (RLF) results in defects in heart development in the mouse.Bourke LM, Del Monte-Nieto G, Outhwaite JE, Bharti V, Pollock PM, Simmons DG, Adam A, Hur SS, Maghzal GJ, Whitelaw E, Stocker R, Suter CM, Harvey RP, Harten SK. Differentiation. 2016 Dec 5;94:8-20. |