RING1 purified MaxPab mouse polyclonal antibody (B01P) View larger

RING1 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RING1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about RING1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00006015-B01P
Product name: RING1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human RING1 protein.
Gene id: 6015
Gene name: RING1
Gene alias: RING1A|RNF1
Gene description: ring finger protein 1
Genbank accession: BC002922.1
Immunogen: RING1 (AAH02922.1, 1 a.a. ~ 377 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMSGGEGEPGEGEGDGEDVSSDSAPDSAPGPAPKRPRGGGAGGSSVGTGGGGTGGVGGGAGSEDSGDRGGTLGGGTLGPPSPPGAPSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLALRIALERRQQQEAGEPGGPGGGASDTGGPDGCGGEGGGAGGGDGPEEPALPSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVSRPLELCYAPTKDPK
Protein accession: AAH02922.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006015-B01P-13-15-1.jpg
Application image note: Western Blot analysis of RING1 expression in transfected 293T cell line (H00006015-T01) by RING1 MaxPab polyclonal antibody.

Lane 1: RING1 transfected lysate(41.47 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RING1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart