RLN1 MaxPab mouse polyclonal antibody (B01) View larger

RLN1 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RLN1 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about RLN1 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00006013-B01
Product name: RLN1 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human RLN1 protein.
Gene id: 6013
Gene name: RLN1
Gene alias: H1|RLXH1|bA12D24.3.1|bA12D24.3.2
Gene description: relaxin 1
Genbank accession: NM_006911.2
Immunogen: RLN1 (NP_008842.1, 1 a.a. ~ 185 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPRLFLFHLLEFCLLLNQFSRAVAAKWKDDVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALKDSNLSFEEFKKLIRNRQSEAADSNPSELKYLGLDTHSQKKRRPYVALFEKCCLIGCTKRSLAKYC
Protein accession: NP_008842.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006013-B01-13-15-1.jpg
Application image note: Western Blot analysis of RLN1 expression in transfected 293T cell line (H00006013-T01) by RLN1 MaxPab polyclonal antibody.

Lane 1: RLN1 transfected lysate(20.35 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RLN1 MaxPab mouse polyclonal antibody (B01) now

Add to cart