| Brand: | Abnova |
| Reference: | H00006011-M02A |
| Product name: | GRK1 monoclonal antibody (M02A), clone 4E9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GRK1. |
| Clone: | 4E9 |
| Isotype: | IgG2b Kappa |
| Gene id: | 6011 |
| Gene name: | GRK1 |
| Gene alias: | GPRK1|RHOK|RK |
| Gene description: | G protein-coupled receptor kinase 1 |
| Genbank accession: | NM_002929 |
| Immunogen: | GRK1 (NP_002920.1, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RDSLSLEFESVCLEQPIGKKLFQQFLQSAEKHLPALELWKDIEDYDTADNDLQPQKAQTILAQYLDPQAKLFCSFLDEGIVAKFKEGPVEIQDGLFQPLL |
| Protein accession: | NP_002920.1 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |