Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RGS13 monoclonal antibody (M06), clone 1B3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,ELISA,WB-Re,WB-Tr |
More info about RGS13 monoclonal antibody (M06), clone 1B3
| Brand: | Abnova |
| Reference: | H00006003-M06 |
| Product name: | RGS13 monoclonal antibody (M06), clone 1B3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RGS13. |
| Clone: | 1B3 |
| Isotype: | IgG2b Kappa |
| Gene id: | 6003 |
| Gene name: | RGS13 |
| Gene alias: | MGC17173 |
| Gene description: | regulator of G-protein signaling 13 |
| Genbank accession: | NM_144766 |
| Immunogen: | RGS13 (NP_658912.1, 60 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NIQFWMACETYKKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQKIVYMHMERDSYPRFLKSEMYQKLLKTMQSNNSF |
| Protein accession: | NP_658912.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of RGS13 expression in transfected 293T cell line by RGS13 monoclonal antibody (M06), clone 1B3. Lane 1: RGS13 transfected lysate(19.1 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IHC-P,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Clinicopathological characteristics and genomic profile of primary sinonasal tract diffuse large B-cell lymphoma (DLBCL) reveals gain at 1q31 and RGS1 encoding protein; high RGS1 immunohistochemical expression associates with poor overall survival in DLBCL NOS.Carreras J, Kikuti YY, Bea S, Miyaoka M, Hiraiwa S, Ikoma H, Nagao R, Martin-Garcia D, Salaverria I, Sato A, Akifumi I, Roncador G, Garcia JF, Ando K, Campo E, Nakamura N. Histopathology. 2016 Oct 24. [Epub ahead of print] |