| Brand: | Abnova |
| Reference: | H00005984-M02 |
| Product name: | RFC4 monoclonal antibody (M02), clone 1B2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RFC4. |
| Clone: | 1B2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5984 |
| Gene name: | RFC4 |
| Gene alias: | A1|MGC27291|RFC37 |
| Gene description: | replication factor C (activator 1) 4, 37kDa |
| Genbank accession: | BC017452 |
| Immunogen: | RFC4 (AAH17452, 254 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLSQNC |
| Protein accession: | AAH17452 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged RFC4 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |