| Brand: | Abnova |
| Reference: | H00005980-A01 |
| Product name: | REV3L polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant REV3L. |
| Gene id: | 5980 |
| Gene name: | REV3L |
| Gene alias: | POLZ|REV3 |
| Gene description: | REV3-like, catalytic subunit of DNA polymerase zeta (yeast) |
| Genbank accession: | NM_002912 |
| Immunogen: | REV3L (NP_002903, 2953 a.a. ~ 3052 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | GTISQYFTTLHCPVCDDLTQHGICSKCRSQPQHVAVILNQEIRELERQQEQLVKICKNCTGCFDRHIPCVSLNCPVLFKLSRVNRELSKAPYLRQLLDQF |
| Protein accession: | NP_002903 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | REV3L 3'UTR 460 T>C polymorphism in microRNA target sites contributes to lung cancer susceptibility.Zhang S, Chen H, Zhao X, Cao J, Tong J, Lu J, Wu W, Shen H, Wei Q, Lu D. Oncogene. 2012 Feb 20. doi: 10.1038/onc.2012.32. [Epub ahead of print] |