Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of UPF1 monoclonal antibody (M01A), clone 4G3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about UPF1 monoclonal antibody (M01A), clone 4G3
| Brand: | Abnova |
| Reference: | H00005976-M01A |
| Product name: | UPF1 monoclonal antibody (M01A), clone 4G3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant UPF1. |
| Clone: | 4G3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5976 |
| Gene name: | UPF1 |
| Gene alias: | FLJ43809|FLJ46894|HUPF1|KIAA0221|NORF1|RENT1|pNORF1 |
| Gene description: | UPF1 regulator of nonsense transcripts homolog (yeast) |
| Genbank accession: | NM_002911 |
| Immunogen: | UPF1 (NP_002902.2, 1019 a.a. ~ 1116 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQGYISMSQPSQMSQPGLSQPELSQDSYLGDEFKSQIDVALSQDSTYQGERAYQHGGVTGLS |
| Protein accession: | NP_002902.2 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |