| Brand: | Abnova |
| Reference: | H00005950-M07 |
| Product name: | RBP4 monoclonal antibody (M07), clone 3D12 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant RBP4. |
| Clone: | 3D12 |
| Isotype: | IgG1 Lambda |
| Gene id: | 5950 |
| Gene name: | RBP4 |
| Gene alias: | - |
| Gene description: | retinol binding protein 4, plasma |
| Genbank accession: | BC020633 |
| Immunogen: | RBP4 (AAH20633.1, 19 a.a. ~ 201 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL |
| Protein accession: | AAH20633.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (45.87 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to RBP4 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | High liver RBP4 protein content is associated with histological features in patients with genotype 1 chronic hepatitis C and with nonalcoholic steatohepatitis.Petta S, Tripodo C, Grimaudo S, Cabibi D, Camma C, Di Cristina A, Di Marco V, Di Vita G, Ingrao S, Mazzola A, Marchesini G, Pipitone R, Craxi A. Dig Liver Dis. 2011 Feb 14. [Epub ahead of print] |