RBP4 monoclonal antibody (M04), clone 3B1 View larger

RBP4 monoclonal antibody (M04), clone 3B1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RBP4 monoclonal antibody (M04), clone 3B1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about RBP4 monoclonal antibody (M04), clone 3B1

Brand: Abnova
Reference: H00005950-M04
Product name: RBP4 monoclonal antibody (M04), clone 3B1
Product description: Mouse monoclonal antibody raised against a full length recombinant RBP4.
Clone: 3B1
Isotype: IgG1 Kappa
Gene id: 5950
Gene name: RBP4
Gene alias: -
Gene description: retinol binding protein 4, plasma
Genbank accession: BC020633
Immunogen: RBP4 (AAH20633.1, 19 a.a. ~ 201 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Protein accession: AAH20633.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005950-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (45.87 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005950-M04-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged RBP4 is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RBP4 monoclonal antibody (M04), clone 3B1 now

Add to cart