No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00005934-M08 |
Product name: | RBL2 monoclonal antibody (M08), clone 2H7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RBL2. |
Clone: | 2H7 |
Isotype: | IgG2a Kappa |
Gene id: | 5934 |
Gene name: | RBL2 |
Gene alias: | FLJ26459|P130|Rb2 |
Gene description: | retinoblastoma-like 2 (p130) |
Genbank accession: | NM_005611 |
Immunogen: | RBL2 (NP_005602, 416 a.a. ~ 515 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VTPVSTATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMFEIYSQHFQPDEDFSNCAKEIASKHFRFAEMLYYKVLESVIEQEQKRLG |
Protein accession: | NP_005602 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged RBL2 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |