No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
| Brand: | Abnova |
| Reference: | H00005934-M07 |
| Product name: | RBL2 monoclonal antibody (M07), clone 4D7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RBL2. |
| Clone: | 4D7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5934 |
| Gene name: | RBL2 |
| Gene alias: | FLJ26459|P130|Rb2 |
| Gene description: | retinoblastoma-like 2 (p130) |
| Genbank accession: | NM_005611 |
| Immunogen: | RBL2 (NP_005602, 416 a.a. ~ 515 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VTPVSTATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMFEIYSQHFQPDEDFSNCAKEIASKHFRFAEMLYYKVLESVIEQEQKRLG |
| Protein accession: | NP_005602 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged RBL2 is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |