No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr,PLA-Ce |
| Brand: | Abnova |
| Reference: | H00005933-M01 |
| Product name: | RBL1 monoclonal antibody (M01), clone 1A5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RBL1. |
| Clone: | 1A5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5933 |
| Gene name: | RBL1 |
| Gene alias: | CP107|MGC40006|PRB1|p107 |
| Gene description: | retinoblastoma-like 1 (p107) |
| Genbank accession: | BC032247 |
| Immunogen: | RBL1 (AAH32247, 905 a.a. ~ 1014 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IDCDLEDATKTPDCSSGPVKEERGDLIKFYNTIYVGRVKSFALKYDLANQDHMMDAPPLSPFPHIKQQPGSPRRISQQHSIYISPHKNGSGLTPRSALLYKFNGSPSKVR |
| Protein accession: | AAH32247 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Proximity Ligation Analysis of protein-protein interactions between MYBL2 and RBL1. Mahlavu cells were stained with anti-MYBL2 rabbit purified polyclonal 1:1200 and anti-RBL1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
| Applications: | ELISA,WB-Re,WB-Tr,PLA-Ce |
| Shipping condition: | Dry Ice |