| Brand: | Abnova |
| Reference: | H00005925-A01 |
| Product name: | RB1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant RB1. |
| Gene id: | 5925 |
| Gene name: | RB1 |
| Gene alias: | OSRC|RB|p105-Rb|pRb|pp110 |
| Gene description: | retinoblastoma 1 |
| Genbank accession: | BC040540 |
| Immunogen: | RB1 (AAH40540, 371 a.a. ~ 470 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | PHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSI |
| Protein accession: | AAH40540 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |