Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RASA1 monoclonal antibody (M01), clone 2C12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
More info about RASA1 monoclonal antibody (M01), clone 2C12
| Brand: | Abnova |
| Reference: | H00005921-M01 |
| Product name: | RASA1 monoclonal antibody (M01), clone 2C12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RASA1. |
| Clone: | 2C12 |
| Isotype: | IgG1 kappa |
| Gene id: | 5921 |
| Gene name: | RASA1 |
| Gene alias: | CM-AVM|CMAVM|DKFZp434N071|GAP|PKWS|RASA|RASGAP|p120GAP|p120RASGAP |
| Gene description: | RAS p21 protein activator (GTPase activating protein) 1 |
| Genbank accession: | NM_002890 |
| Immunogen: | RASA1 (NP_002881, 948 a.a. ~ 1047 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AKEPYMEGVNPFIKSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELLQQKQNQYTKTNDVR |
| Protein accession: | NP_002881 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to RASA1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 6 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |