No products
Prices are tax excluded
Brand | Abnova |
Product type | Proteins |
Applications | AP,Array,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00005919-P02 |
Product name: | RARRES2 (Human) Recombinant Protein (P02) |
Product description: | Human RARRES2 full-length ORF (NP_002880.1, 17 a.a. - 163 a.a.) recombinant protein with GST tag at N-terminal. |
Gene id: | 5919 |
Gene name: | RARRES2 |
Gene alias: | CHEMERIN|HP10433|TIG2 |
Gene description: | retinoic acid receptor responder (tazarotene induced) 2 |
Genbank accession: | NM_002889.2 |
Immunogen sequence/protein sequence: | VGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSKALPRS |
Protein accession: | NP_002880.1 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue |
Quality control testing picture: | ![]() |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |