RARA monoclonal antibody (M09), clone 2C3 View larger

RARA monoclonal antibody (M09), clone 2C3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RARA monoclonal antibody (M09), clone 2C3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,ELISA,WB-Re

More info about RARA monoclonal antibody (M09), clone 2C3

Brand: Abnova
Reference: H00005914-M09
Product name: RARA monoclonal antibody (M09), clone 2C3
Product description: Mouse monoclonal antibody raised against a partial recombinant RARA.
Clone: 2C3
Isotype: IgG1 Kappa
Gene id: 5914
Gene name: RARA
Gene alias: NR1B1|RAR
Gene description: retinoic acid receptor, alpha
Genbank accession: NM_000964
Immunogen: RARA (NP_000955, 315 a.a. ~ 424 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLS
Protein accession: NP_000955
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005914-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005914-M09-1-25-1.jpg
Application image note: RARA monoclonal antibody (M09), clone 2C3. Western Blot analysis of RARA expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RARA monoclonal antibody (M09), clone 2C3 now

Add to cart