RARA monoclonal antibody (M03), clone 2D2 View larger

RARA monoclonal antibody (M03), clone 2D2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RARA monoclonal antibody (M03), clone 2D2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re

More info about RARA monoclonal antibody (M03), clone 2D2

Brand: Abnova
Reference: H00005914-M03
Product name: RARA monoclonal antibody (M03), clone 2D2
Product description: Mouse monoclonal antibody raised against a partial recombinant RARA.
Clone: 2D2
Isotype: IgG1 Kappa
Gene id: 5914
Gene name: RARA
Gene alias: NR1B1|RAR
Gene description: retinoic acid receptor, alpha
Genbank accession: NM_000964
Immunogen: RARA (NP_000955, 315 a.a. ~ 424 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLS
Protein accession: NP_000955
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005914-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005914-M03-3-35-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to RARA on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1.2 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Moz and Retinoic Acid Coordinately Regulate H3K9 Acetylation, Hox Gene Expression, and Segment Identity.Voss AK, Collin C, Dixon MP, Thomas T.
Dev Cell. 2009 Nov;17(5):674-86.

Reviews

Buy RARA monoclonal antibody (M03), clone 2D2 now

Add to cart