Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RAP2B monoclonal antibody (M01), clone 4F12-3C6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about RAP2B monoclonal antibody (M01), clone 4F12-3C6
| Brand: | Abnova |
| Reference: | H00005912-M01 |
| Product name: | RAP2B monoclonal antibody (M01), clone 4F12-3C6 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant RAP2B. |
| Clone: | 4F12-3C6 |
| Isotype: | IgG2b kappa |
| Gene id: | 5912 |
| Gene name: | RAP2B |
| Gene alias: | MGC20484 |
| Gene description: | RAP2B, member of RAS oncogene family |
| Genbank accession: | BC012362 |
| Immunogen: | RAP2B (AAH12362, 1 a.a. ~ 183 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL |
| Protein accession: | AAH12362 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (45.87 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to RAP2B on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue. [antibody concentration 1 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |