Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RAP2A polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about RAP2A polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00005911-A01 |
| Product name: | RAP2A polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant RAP2A. |
| Gene id: | 5911 |
| Gene name: | RAP2A |
| Gene alias: | K-REV|KREV|RAP2|RbBP-30 |
| Gene description: | RAP2A, member of RAS oncogene family |
| Genbank accession: | BC041333 |
| Immunogen: | RAP2A (AAH41333, 1 a.a. ~ 183 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGCPFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ |
| Protein accession: | AAH41333 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (46.24 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of RAP2A expression in transfected 293T cell line by RAP2A polyclonal antibody (A01). Lane1:RAP2A transfected lysate(20.6 KDa). Lane2:Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |