Brand: | Abnova |
Reference: | H00005900-M01 |
Product name: | RALGDS monoclonal antibody (M01), clone 1A11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RALGDS. |
Clone: | 1A11 |
Isotype: | IgG1 Kappa |
Gene id: | 5900 |
Gene name: | RALGDS |
Gene alias: | FLJ20922|RGF|RalGEF |
Gene description: | ral guanine nucleotide dissociation stimulator |
Genbank accession: | BC059362 |
Immunogen: | RALGDS (AAH59362, 793 a.a. ~ 902 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEEEEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRTFTKGVKVKHGASSTLPRMKQKGLKIAKGIF |
Protein accession: | AAH59362 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged RALGDS is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,PLA-Ce |
Shipping condition: | Dry Ice |