No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Rat |
Host species | Mouse |
Applications | WB-Ti,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00005897-M06 |
Product name: | RAG2 monoclonal antibody (M06), clone 2G8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RAG2. |
Clone: | 2G8 |
Isotype: | IgG2b Kappa |
Gene id: | 5897 |
Gene name: | RAG2 |
Gene alias: | RAG-2 |
Gene description: | recombination activating gene 2 |
Genbank accession: | NM_000536 |
Immunogen: | RAG2 (NP_000527.1, 428 a.a. ~ 527 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLAERTLIHLSAGSNKYYCNEHVEIARALHTPQRVLPLKKPPMKSLRKKGSGKILTPAKKSFLRRLFD |
Protein accession: | NP_000527.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged RAG2 is approximately 1ng/ml as a capture antibody. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |