Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RAF1 monoclonal antibody (M03), clone 1H4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,WB-Ti,ELISA,WB-Re,WB-Tr,RNAi-Ab,PLA-Ce |
More info about RAF1 monoclonal antibody (M03), clone 1H4
| Brand: | Abnova |
| Reference: | H00005894-M03 |
| Product name: | RAF1 monoclonal antibody (M03), clone 1H4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RAF1. |
| Clone: | 1H4 |
| Isotype: | IgG2b Kappa |
| Gene id: | 5894 |
| Gene name: | RAF1 |
| Gene alias: | CRAF|NS5|Raf-1|c-Raf |
| Gene description: | v-raf-1 murine leukemia viral oncogene homolog 1 |
| Genbank accession: | BC018119 |
| Immunogen: | RAF1 (AAH18119, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIRVFLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAASLIGEELQVDF |
| Protein accession: | AAH18119 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (39.93 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | Western blot analysis of RAF1 over-expressed 293 cell line, cotransfected with RAF1 Validated Chimera RNAi ( Cat # H00005894-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RAF1 monoclonal antibody (M03) clone 1H4 (Cat # H00005894-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
| Applications: | WB-Ce,WB-Ti,ELISA,WB-Re,WB-Tr,RNAi-Ab,PLA-Ce |
| Shipping condition: | Dry Ice |