RAD51C polyclonal antibody (A01) View larger

RAD51C polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAD51C polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about RAD51C polyclonal antibody (A01)

Brand: Abnova
Reference: H00005889-A01
Product name: RAD51C polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a full-length recombinant RAD51C.
Gene id: 5889
Gene name: RAD51C
Gene alias: MGC104277|RAD51L2
Gene description: RAD51 homolog C (S. cerevisiae)
Genbank accession: BC000667
Immunogen: RAD51C (AAH00667.1, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVGKTQL
Protein accession: AAH00667.1
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005889-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (40.85 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RAD51C polyclonal antibody (A01) now

Add to cart