Cart 22 Product Products 9 101,16 € (empty)
No products
To be determined Shipping
9 101,16 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 22 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 9 101,16 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 9 101,16 €
Data sheet of RAD23B monoclonal antibody (M10), clone 3H7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about RAD23B monoclonal antibody (M10), clone 3H7
| Brand: | Abnova |
| Reference: | H00005887-M10 |
| Product name: | RAD23B monoclonal antibody (M10), clone 3H7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RAD23B. |
| Clone: | 3H7 |
| Isotype: | IgG2b Kappa |
| Gene id: | 5887 |
| Gene name: | RAD23B |
| Gene alias: | HHR23B|HR23B|P58 |
| Gene description: | RAD23 homolog B (S. cerevisiae) |
| Genbank accession: | NM_002874 |
| Immunogen: | RAD23B (NP_002865.1, 311 a.a. ~ 409 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED |
| Protein accession: | NP_002865.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of RAD23B expression in transfected 293T cell line by RAD23B monoclonal antibody (M10), clone 3H7. Lane 1: RAD23B transfected lysate(43.2 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |