Brand: | Abnova |
Reference: | H00005886-M01 |
Product name: | RAD23A monoclonal antibody (M01), clone 3C12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RAD23A. |
Clone: | 3C12 |
Isotype: | IgG2a Kappa |
Gene id: | 5886 |
Gene name: | RAD23A |
Gene alias: | HHR23A|MGC111083 |
Gene description: | RAD23 homolog A (S. cerevisiae) |
Genbank accession: | BC014026 |
Immunogen: | RAD23A (AAH14026, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EDAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQ |
Protein accession: | AAH14026 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Western blot analysis of RAD23A over-expressed 293 cell line, cotransfected with RAD23A Validated Chimera RNAi ( Cat # H00005886-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RAD23A monoclonal antibody (M01), clone 3C12 (Cat # H00005886-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
Applications: | S-ELISA,ELISA,WB-Re,RNAi-Ab |
Shipping condition: | Dry Ice |
Publications: | hHR23A is required to control the basal turnover of Chk1.Tana X, Lianga RY,Chuang SM. Cell Signal. 2015 Nov;27(11):2304-13. |