RAC2 monoclonal antibody (M04A), clone M1 View larger

RAC2 monoclonal antibody (M04A), clone M1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAC2 monoclonal antibody (M04A), clone M1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about RAC2 monoclonal antibody (M04A), clone M1

Brand: Abnova
Reference: H00005880-M04A
Product name: RAC2 monoclonal antibody (M04A), clone M1
Product description: Mouse monoclonal antibody raised against a full-length recombinant RAC2.
Clone: M1
Isotype: IgM Kappa
Gene id: 5880
Gene name: RAC2
Gene alias: EN-7|Gx|HSPC022
Gene description: ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
Genbank accession: BC001485
Immunogen: RAC2 (AAH01485.1, 1 a.a. ~ 192 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL
Protein accession: AAH01485.1
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005880-M04A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (46.86 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RAC2 monoclonal antibody (M04A), clone M1 now

Add to cart