| Brand: | Abnova |
| Reference: | H00005880-M01A |
| Product name: | RAC2 monoclonal antibody (M01A), clone 3B10-2D9 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant RAC2. |
| Clone: | 3B10-2D9 |
| Isotype: | IgM Kappa |
| Gene id: | 5880 |
| Gene name: | RAC2 |
| Gene alias: | EN-7|Gx|HSPC022 |
| Gene description: | ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) |
| Genbank accession: | BC001485 |
| Immunogen: | RAC2 (AAH01485.1, 1 a.a. ~ 192 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL |
| Protein accession: | AAH01485.1 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (46.86 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |