RAC2 polyclonal antibody (A01) View larger

RAC2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAC2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about RAC2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00005880-A01
Product name: RAC2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a full-length recombinant RAC2.
Gene id: 5880
Gene name: RAC2
Gene alias: EN-7|Gx|HSPC022
Gene description: ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
Genbank accession: BC001485
Immunogen: RAC2 (AAH01485.1, 1 a.a. ~ 192 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL
Protein accession: AAH01485.1
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy RAC2 polyclonal antibody (A01) now

Add to cart