Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RABGGTB monoclonal antibody (M02), clone 1C2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA |
More info about RABGGTB monoclonal antibody (M02), clone 1C2
| Brand: | Abnova |
| Reference: | H00005876-M02 |
| Product name: | RABGGTB monoclonal antibody (M02), clone 1C2 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant RABGGTB. |
| Clone: | 1C2 |
| Isotype: | IgG1 kappa |
| Gene id: | 5876 |
| Gene name: | RABGGTB |
| Gene alias: | GGTB |
| Gene description: | Rab geranylgeranyltransferase, beta subunit |
| Genbank accession: | BC020790 |
| Immunogen: | RABGGTB (AAH20790, 1 a.a. ~ 331 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGTPQKDVIIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGIYWGLTVMDLMGQLHRMNREEILAFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSINVIDVNKVVEYVKGLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRNFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVNPVFCMPEEVLQRVNVQPELVS |
| Protein accession: | AAH20790 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | RABGGTB monoclonal antibody (M02), clone 1C2 Western Blot analysis of RABGGTB expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Inhibition of geranylgeranylation mediates sensitivity to CHOP-induced cell death of DLBCL cell lines.Ageberg M, Rydstrom K, Linden O, Linderoth J, Jerkeman M, Drott K. Exp Cell Res. 2011 Feb 12. [Epub ahead of print] |